Anti-CADM4

Artikelnummer: ATA-HPA012612
Artikelname: Anti-CADM4
Artikelnummer: ATA-HPA012612
Hersteller Artikelnummer: HPA012612
Alternativnummer: ATA-HPA012612-100,ATA-HPA012612-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IGSF4C, Necl-4, SynCAM4, TSLL2
cell adhesion molecule 4
Anti-CADM4
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 199731
UniProt: Q8NFZ8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CADM4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CADM4 antibody. Corresponding CADM4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA012612-100ul
HPA012612-100ul
HPA012612-100ul