Anti-C15orf48
Artikelnummer:
ATA-HPA012943
- Bilder (7)
| Artikelname: | Anti-C15orf48 |
| Artikelnummer: | ATA-HPA012943 |
| Hersteller Artikelnummer: | HPA012943 |
| Alternativnummer: | ATA-HPA012943-100,ATA-HPA012943-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NMES1 |
| chromosome 15 open reading frame 48 |
| Anti-C15orf48 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84419 |
| UniProt: | Q9C002 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C15orf48 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human colon and liver tissues using Anti-C15orf48 antibody. Corresponding C15orf48 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 150, 100, 75, 50, 37, 25, 20, 15, 10, 5, 2 Lane 2: Human cell line A-431 |
|
|
HPA012943-100ul |
|
|
HPA012943-100ul |
|
|
HPA012943-100ul |
Produktgarantie und fachkundiger Support
