Anti-NETO2
Artikelnummer:
ATA-HPA013180
- Bilder (8)
| Artikelname: | Anti-NETO2 |
| Artikelnummer: | ATA-HPA013180 |
| Hersteller Artikelnummer: | HPA013180 |
| Alternativnummer: | ATA-HPA013180-100,ATA-HPA013180-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10430, NEOT2 |
| neuropilin (NRP) and tolloid (TLL)-like 2 |
| Anti-NETO2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 81831 |
| UniProt: | Q8NC67 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NETO2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus. |
|
|
Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA013180-100ul |
|
|
|
|
|
|
|
|
HPA013180-100ul |
|
|
HPA013180-100ul |
Produktgarantie und fachkundiger Support
