Anti-C16orf89
Artikelnummer:
ATA-HPA013613
- Bilder (8)
| Artikelname: | Anti-C16orf89 |
| Artikelnummer: | ATA-HPA013613 |
| Hersteller Artikelnummer: | HPA013613 |
| Alternativnummer: | ATA-HPA013613-100,ATA-HPA013613-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC45438 |
| chromosome 16 open reading frame 89 |
| Anti-C16orf89 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 146556 |
| UniProt: | Q6UX73 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C16orf89 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human colon, kidney, testis and thyroid gland using Anti-C16orf89 antibody HPA013613 (A) shows similar protein distribution across tissues to independent antibody HPA016934 (B). |
|
|
Immunohistochemical staining of human thyroid gland using Anti-C16orf89 antibody HPA013613. |
|
|
Immunohistochemical staining of human testis using Anti-C16orf89 antibody HPA013613. |
|
|
Immunohistochemical staining of human colon using Anti-C16orf89 antibody HPA013613. |
|
|
Immunohistochemical staining of human kidney using Anti-C16orf89 antibody HPA013613. |
|
|
HPA013613-100ul |
|
|
HPA013613-100ul |
|
|
HPA013613-100ul |
Produktgarantie und fachkundiger Support
