Anti-DPCR1
Artikelnummer:
ATA-HPA014036
- Bilder (6)
| Artikelname: | Anti-DPCR1 |
| Artikelnummer: | ATA-HPA014036 |
| Hersteller Artikelnummer: | HPA014036 |
| Alternativnummer: | ATA-HPA014036-100,ATA-HPA014036-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bCX105N19.6, PBLT |
| diffuse panbronchiolitis critical region 1 |
| Anti-DPCR1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 135656 |
| UniProt: | Q3MIW9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DPCR1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human stomach and pancreas tissues using Anti-DPCR1 antibody. Corresponding DPCR1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA014036-100ul |
|
|
HPA014036-100ul |
|
|
HPA014036-100ul |
Produktgarantie und fachkundiger Support
