Anti-CNN1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA014263
Artikelname: Anti-CNN1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA014263
Hersteller Artikelnummer: HPA014263
Alternativnummer: ATA-HPA014263-100,ATA-HPA014263-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Sm-Calp, SMCC
calponin 1, basic, smooth muscle
Anti-CNN1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 1264
UniProt: P51911
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CNN1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human smooth muscle and skeletal muscle tissues using Anti-CNN1 antibody. Corresponding CNN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human smooth muscle shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human prostate tissue.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA014263
HPA014263
HPA014263