Anti-UGT8
Artikelnummer:
ATA-HPA014405
- Bilder (7)
| Artikelname: | Anti-UGT8 |
| Artikelnummer: | ATA-HPA014405 |
| Hersteller Artikelnummer: | HPA014405 |
| Alternativnummer: | ATA-HPA014405-100,ATA-HPA014405-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGT |
| UDP glycosyltransferase 8 |
| Anti-UGT8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7368 |
| UniProt: | Q16880 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UGT8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in glial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells. |
|
|
Immunohistochemical staining of human duodenum shows strong positivity in apical membrane of glandular cells, as well as moderate cytoplasmic immunoreactivity. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA014405-100ul |
|
|
HPA014405-100ul |
|
|
HPA014405-100ul |
Produktgarantie und fachkundiger Support
