Anti-PDE3A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA014492
Artikelname: Anti-PDE3A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA014492
Hersteller Artikelnummer: HPA014492
Alternativnummer: ATA-HPA014492-100,ATA-HPA014492-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CGI-PDE
phosphodiesterase 3A, cGMP-inhibited
Anti-PDE3A
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5139
UniProt: Q14432
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYAPETMMFLDKPILAPEPLVMDNLDSIMEQLNT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PDE3A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line HeLa shows localization to cytosol.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines HeLa and HEK293 using Anti-PDE3A antibody. Corresponding PDE3A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western blot analysis in human cell line HEL.
HPA014492
HPA014492
HPA014492