Anti-BVES
Artikelnummer:
ATA-HPA014788
- Bilder (8)
| Artikelname: | Anti-BVES |
| Artikelnummer: | ATA-HPA014788 |
| Hersteller Artikelnummer: | HPA014788 |
| Alternativnummer: | ATA-HPA014788-100,ATA-HPA014788-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HBVES, POP1, POPDC1 |
| blood vessel epicardial substance |
| Anti-BVES |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11149 |
| UniProt: | Q8NE79 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BVES |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to cell junctions. |
|
|
Immunohistochemistry analysis in human heart muscle and tonsil tissues using Anti-BVES antibody. Corresponding BVES RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
HPA014788-100ul |
|
|
|
|
|
HPA014788-100ul |
|
|
HPA014788-100ul |
Produktgarantie und fachkundiger Support
