Anti-GYPA
Artikelnummer:
ATA-HPA014811
- Bilder (7)
| Artikelname: | Anti-GYPA |
| Artikelnummer: | ATA-HPA014811 |
| Hersteller Artikelnummer: | HPA014811 |
| Alternativnummer: | ATA-HPA014811-100,ATA-HPA014811-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD235a, GPA, MN, MNS |
| glycophorin A (MNS blood group) |
| Anti-GYPA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2993 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GYPA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human liver shows moderate membranous positivity in erythrocytes. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in erythrocytes. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in erythrocytes. |
|
|
HPA014811-100ul |
|
|
HPA014811-100ul |
|
|
HPA014811-100ul |
Produktgarantie und fachkundiger Support
