Anti-GPRC5B
Artikelnummer:
ATA-HPA015247
- Bilder (8)
| Artikelname: | Anti-GPRC5B |
| Artikelnummer: | ATA-HPA015247 |
| Hersteller Artikelnummer: | HPA015247 |
| Alternativnummer: | ATA-HPA015247-100,ATA-HPA015247-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RAIG-2 |
| G protein-coupled receptor, class C, group 5, member B |
| Anti-GPRC5B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51704 |
| UniProt: | Q9NZH0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GPRC5B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & vesicles. |
|
|
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-GPRC5B antibody. Corresponding GPRC5B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
HPA015247-100ul |
|
|
|
|
|
HPA015247-100ul |
|
|
HPA015247-100ul |
Produktgarantie und fachkundiger Support
