Anti-STK4
Artikelnummer:
ATA-HPA015270
- Bilder (8)
| Artikelname: | Anti-STK4 |
| Artikelnummer: | ATA-HPA015270 |
| Hersteller Artikelnummer: | HPA015270 |
| Alternativnummer: | ATA-HPA015270-100,ATA-HPA015270-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KRS2, MST1, YSK3 |
| serine/threonine kinase 4 |
| Anti-STK4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6789 |
| UniProt: | Q13043 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | STK4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm, nuclear bodies & cytosol. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in cells outside reaction centra. |
|
|
Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-STK4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line CACO-2. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA015270-100ul |
|
|
HPA015270-100ul |
|
|
HPA015270-100ul |
Produktgarantie und fachkundiger Support
