Anti-MYH11 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA015310
Artikelname: Anti-MYH11 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA015310
Hersteller Artikelnummer: HPA015310
Alternativnummer: ATA-HPA015310-100,ATA-HPA015310-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SMHC, SMMHC
myosin, heavy chain 11, smooth muscle
Anti-MYH11
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 4629
UniProt: P35749
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MYH11
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-MYH11 antibody. Corresponding MYH11 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Esophagus tissue
HPA015310
HPA015310
HPA015310