Anti-TMEM132C, Rabbit, Polyclonal

Artikelnummer: ATA-HPA015633
Artikelname: Anti-TMEM132C, Rabbit, Polyclonal
Artikelnummer: ATA-HPA015633
Hersteller Artikelnummer: HPA015633
Alternativnummer: ATA-HPA015633-100,ATA-HPA015633-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp761O2018, PPP1R152
transmembrane protein 132C
Anti-TMEM132C
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 92293
UniProt: Q8N3T6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KQVPLEGQASMTHSHDWVWLGNEAELLESMGDAPPPQDEHTTIIDRGPGACEESNHLLLNGGSHKHVQSQIHRSADSGGRQGREQKQDPLHSPTSKRKKVKFTTFTTIPPDDSCPTVNSIVSSN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & centrosome.