Anti-DEFA5 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA015775
Artikelname: Anti-DEFA5 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA015775
Hersteller Artikelnummer: HPA015775
Alternativnummer: ATA-HPA015775-100,ATA-HPA015775-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DEF5, HD-5
defensin, alpha 5, Paneth cell-specific
Anti-DEFA5
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 1670
UniProt: Q01523
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DEFA5
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human small intestine and placenta tissues using Anti-DEFA5 antibody. Corresponding DEFA5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows low expression as expected.
Immunohistochemical staining of human small intestine shows high expression.
Western blot analysis in human small intestine tissue.
Western blot analysis in control (vector only transfected HEK293T lysate) and DEFA5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412137).
HPA015775
HPA015775
HPA015775