Anti-FAM3B Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA015885
Artikelname: Anti-FAM3B Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA015885
Hersteller Artikelnummer: HPA015885
Alternativnummer: ATA-HPA015885-100,ATA-HPA015885-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: 2-21, C21orf11, C21orf76, D21M16SJHU19e, ORF9, PANDER, PRED44
family with sequence similarity 3, member B
Anti-FAM3B
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 54097
UniProt: P58499
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FAM3B
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human duodenum shows strong positivity in cytoplasm granular in glandular cells.
Immunohistochemical staining of human pancreas shows strong granular positivity in cytoplasm in exocrine glandular cells.
Immunohistochemical staining of human prostate shows weak to moderate positivity in cytoplasm granular in glandular cells.
Immunohistochemical staining of human lymph node shows no positivity in germinal center cells as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and FAM3B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403301).
HPA015885
HPA015885
HPA015885