Anti-CTNND1
Artikelnummer:
ATA-HPA015955
- Bilder (8)
| Artikelname: | Anti-CTNND1 |
| Artikelnummer: | ATA-HPA015955 |
| Hersteller Artikelnummer: | HPA015955 |
| Alternativnummer: | ATA-HPA015955-100,ATA-HPA015955-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CTNND, KIAA0384, p120, p120cas, p120ctn |
| catenin (cadherin-associated protein), delta 1 |
| Anti-CTNND1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1500 |
| UniProt: | O60716 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CTNND1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-431 and HEK293 using Anti-CTNND1 antibody. Corresponding CTNND1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis using Anti-CTNND1 antibody HPA015955 (A) shows similar pattern to independent antibody HPA015954 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA015955-100ul |
|
|
HPA015955-100ul |
|
|
HPA015955-100ul |
Produktgarantie und fachkundiger Support
