Anti-PIGG
Artikelnummer:
ATA-HPA015997
- Bilder (4)
| Artikelname: | Anti-PIGG |
| Artikelnummer: | ATA-HPA015997 |
| Hersteller Artikelnummer: | HPA015997 |
| Alternativnummer: | ATA-HPA015997-100,ATA-HPA015997-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20265, GPI7, LAS21 |
| phosphatidylinositol glycan anchor biosynthesis, class G |
| Anti-PIGG |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54872 |
| UniProt: | Q5H8A4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PIGG |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells. |
|
|
HPA015997-100ul |
|
|
HPA015997-100ul |
|
|
HPA015997-100ul |
Produktgarantie und fachkundiger Support
