Anti-ASGR2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA015998
Artikelname: Anti-ASGR2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA015998
Hersteller Artikelnummer: HPA015998
Alternativnummer: ATA-HPA015998-100,ATA-HPA015998-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLEC4H2
asialoglycoprotein receptor 2
Anti-ASGR2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 433
UniProt: P07307
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ASGR2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000
Immunohistochemistry analysis in human liver and pancreas tissues using Anti-ASGR2 antibody. Corresponding ASGR2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, liver, lymph node and pancreas using Anti-ASGR2 antibody HPA015998 (A) shows similar protein distribution across tissues to independent antibody HPA014899 (B).
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human lymph node using Anti-ASGR2 antibody HPA015998.
Immunohistochemical staining of human colon using Anti-ASGR2 antibody HPA015998.
HPA015998
HPA015998
HPA015998