Anti-ITPR1
Artikelnummer:
ATA-HPA016487
- Bilder (7)
| Artikelname: | Anti-ITPR1 |
| Artikelnummer: | ATA-HPA016487 |
| Hersteller Artikelnummer: | HPA016487 |
| Alternativnummer: | ATA-HPA016487-100,ATA-HPA016487-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ACV, Insp3r1, IP3R1, PPP1R94, SCA15, SCA16, SCA29 |
| inositol 1,4,5-trisphosphate receptor, type 1 |
| Anti-ITPR1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3708 |
| UniProt: | Q14643 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ITPR1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells. |
|
|
HPA016487-100ul |
|
|
HPA016487-100ul |
|
|
HPA016487-100ul |
Produktgarantie und fachkundiger Support
