Anti-APBB1IP
Artikelnummer:
ATA-HPA017009
- Bilder (8)
| Artikelname: | Anti-APBB1IP |
| Artikelnummer: | ATA-HPA017009 |
| Hersteller Artikelnummer: | HPA017009 |
| Alternativnummer: | ATA-HPA017009-100,ATA-HPA017009-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | INAG1, RIAM |
| amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein |
| Anti-APBB1IP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54518 |
| UniProt: | Q7Z5R6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | APBB1IP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line BJ shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemistry analysis in human spleen and pancreas tissues using Anti-APBB1IP antibody. Corresponding APBB1IP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
HPA017009-100ul |
|
|
|
|
|
HPA017009-100ul |
|
|
HPA017009-100ul |
Produktgarantie und fachkundiger Support
