Anti-PGR
Artikelnummer:
ATA-HPA017176
- Bilder (8)
| Artikelname: | Anti-PGR |
| Artikelnummer: | ATA-HPA017176 |
| Hersteller Artikelnummer: | HPA017176 |
| Alternativnummer: | ATA-HPA017176-100,ATA-HPA017176-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NR3C3, PR |
| progesterone receptor |
| Anti-PGR |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5241 |
| UniProt: | P06401 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PGR |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, endometrium, fallopian tube and testis using Anti-PGR antibody HPA017176 (A) shows similar protein distribution across tissues to independent antibody HPA004751 (B). |
|
|
Immunohistochemical staining of human fallopian tube using Anti-PGR antibody HPA017176. |
|
|
Immunohistochemical staining of human testis using Anti-PGR antibody HPA017176. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-PGR antibody HPA017176. |
|
|
Immunohistochemical staining of human endometrium using Anti-PGR antibody HPA017176. |
|
|
HPA017176-100ul |
|
|
HPA017176-100ul |
|
|
HPA017176-100ul |
Produktgarantie und fachkundiger Support
