Anti-MAN2A2
Artikelnummer:
ATA-HPA017226
- Bilder (7)
| Artikelname: | Anti-MAN2A2 |
| Artikelnummer: | ATA-HPA017226 |
| Hersteller Artikelnummer: | HPA017226 |
| Alternativnummer: | ATA-HPA017226-100,ATA-HPA017226-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HsT19662, MANA2X |
| mannosidase, alpha, class 2A, member 2 |
| Anti-MAN2A2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4122 |
| UniProt: | P49641 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MAN2A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells. |
|
|
Immunohistochemical staining of human thyroid gland shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected. |
|
|
HPA017226-100ul |
|
|
HPA017226-100ul |
|
|
HPA017226-100ul |
Produktgarantie und fachkundiger Support
