Anti-SNW1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA017370
Artikelname: Anti-SNW1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA017370
Hersteller Artikelnummer: HPA017370
Alternativnummer: ATA-HPA017370-100,ATA-HPA017370-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Bx42, NCoA-62, Prp45, PRPF45, SKIIP, SKIP
SNW domain containing 1
Anti-SNW1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 22938
UniProt: Q13573
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SNW1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human esophagus shows strong nuclear membranous positivity in squamous epithelial cells.
Western blot analysis using Anti-SNW1 antibody HPA017370 (A) shows similar pattern to independent antibody HPA002457 (B).
Western blot analysis in human cell line PC-3.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA017370
HPA017370
HPA017370