Anti-SNW1
Artikelnummer:
ATA-HPA017370
| Artikelname: |
Anti-SNW1 |
| Artikelnummer: |
ATA-HPA017370 |
| Hersteller Artikelnummer: |
HPA017370 |
| Alternativnummer: |
ATA-HPA017370-100,ATA-HPA017370-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Sonstiges |
| Applikation: |
ICC, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Bx42, NCoA-62, Prp45, PRPF45, SKIIP, SKIP |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
22938 |
| UniProt: |
Q13573 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
MSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKK |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
SNW1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
Immunohistochemical staining of human esophagus shows strong nuclear membranous positivity in squamous epithelial cells. |
|
Western blot analysis using Anti-SNW1 antibody HPA017370 (A) shows similar pattern to independent antibody HPA002457 (B). |
|
Western blot analysis in human cell line PC-3. |
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
HPA017370-100ul |
|
HPA017370-100ul |
|
HPA017370-100ul |