Anti-NUDT4

Artikelnummer: ATA-HPA017593
Artikelname: Anti-NUDT4
Artikelnummer: ATA-HPA017593
Hersteller Artikelnummer: HPA017593
Alternativnummer: ATA-HPA017593-100,ATA-HPA017593-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DIPP2, DIPP2alpha, DIPP2beta, HDCMB47P, KIAA0487
nudix hydrolase 4
Anti-NUDT4
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 11163
UniProt: Q9NZJ9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NUDT4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines Caco-2 and HeLa using Anti-NUDT4 antibody. Corresponding NUDT4 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA017593-100ul
HPA017593-100ul
HPA017593-100ul