Anti-FZD6
Artikelnummer:
ATA-HPA017991
- Bilder (8)
| Artikelname: | Anti-FZD6 |
| Artikelnummer: | ATA-HPA017991 |
| Hersteller Artikelnummer: | HPA017991 |
| Alternativnummer: | ATA-HPA017991-100,ATA-HPA017991-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Hfz6 |
| frizzled class receptor 6 |
| Anti-FZD6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8323 |
| UniProt: | O60353 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FZD6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human urinary bladder shows strong positivity in urothelial cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FZD6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401182). |
|
|
|
|
|
HPA017991-100ul |
|
|
|
|
|
HPA017991-100ul |
|
|
HPA017991-100ul |
Produktgarantie und fachkundiger Support
