Anti-YBEY
Artikelnummer:
ATA-HPA018162
- Bilder (8)
| Artikelname: | Anti-YBEY |
| Artikelnummer: | ATA-HPA018162 |
| Hersteller Artikelnummer: | HPA018162 |
| Alternativnummer: | ATA-HPA018162-100,ATA-HPA018162-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C21orf57 |
| ybeY metallopeptidase (putative) |
| Anti-YBEY |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54059 |
| UniProt: | P58557 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAGEFP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | YBEY |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human small intestine shows distinct cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line NTERA-2. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA018162-100ul |
|
|
|
|
|
HPA018162-100ul |
|
|
HPA018162-100ul |
Produktgarantie und fachkundiger Support
