Anti-RBM8A
Artikelnummer:
ATA-HPA018403
- Bilder (8)
| Artikelname: | Anti-RBM8A |
| Artikelnummer: | ATA-HPA018403 |
| Hersteller Artikelnummer: | HPA018403 |
| Alternativnummer: | ATA-HPA018403-100,ATA-HPA018403-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BOV-1A, BOV-1B, BOV-1C, RBM8, RBM8B, Y14, ZNRP |
| RNA binding motif protein 8A |
| Anti-RBM8A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9939 |
| UniProt: | Q9Y5S9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RBM8A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts as well as Leydig cells. |
|
|
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
HPA018403-100ul |
|
|
|
|
|
|
|
|
HPA018403-100ul |
|
|
HPA018403-100ul |
Produktgarantie und fachkundiger Support
