Anti-PAPPA2

Artikelnummer: ATA-HPA018412
Artikelname: Anti-PAPPA2
Artikelnummer: ATA-HPA018412
Hersteller Artikelnummer: HPA018412
Alternativnummer: ATA-HPA018412-100,ATA-HPA018412-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PAPP-A2, PAPPE, PLAC3
pappalysin 2
Anti-PAPPA2
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 60676
UniProt: Q9BXP8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTLNEPKPETQRRGWAKSRQRRQVWKRRAEDGQGDSGISSHFQPWPKH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PAPPA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-PAPPA2 antibody. Corresponding PAPPA2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver, lymph node, placenta and prostate using Anti-PAPPA2 antibody HPA018412 (A) shows similar protein distribution across tissues to independent antibody HPA018430 (B).
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Immunohistochemical staining of human liver using Anti-PAPPA2 antibody HPA018412.
Immunohistochemical staining of human lymph node using Anti-PAPPA2 antibody HPA018412.
HPA018412-100ul
HPA018412-100ul
HPA018412-100ul