Anti-C21orf59
Artikelnummer:
ATA-HPA018453
- Bilder (8)
| Artikelname: | Anti-C21orf59 |
| Artikelnummer: | ATA-HPA018453 |
| Hersteller Artikelnummer: | HPA018453 |
| Alternativnummer: | ATA-HPA018453-100,ATA-HPA018453-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C21orf48, CILD26, FBB18, FLJ20467 |
| chromosome 21 open reading frame 59 |
| Anti-C21orf59 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 56683 |
| UniProt: | P57076 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C21orf59 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-C21orf59 antibody. Corresponding C21orf59 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
|
|
|
HPA018453-100ul |
|
|
HPA018453-100ul |
|
|
HPA018453-100ul |
Produktgarantie und fachkundiger Support
