Anti-NOP58
Artikelnummer:
ATA-HPA018472
- Bilder (7)
| Artikelname: | Anti-NOP58 |
| Artikelnummer: | ATA-HPA018472 |
| Hersteller Artikelnummer: | HPA018472 |
| Alternativnummer: | ATA-HPA018472-100,ATA-HPA018472-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HSPC120, NOP5 |
| NOP58 ribonucleoprotein |
| Anti-NOP58 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51602 |
| UniProt: | Q9Y2X3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NOP58 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli fibrillar center. |
|
|
Immunohistochemical staining of human esophagus shows strong nuclear positivity, seen as distinctly stained nucleoli, in squamous epithelial cells. |
|
|
Western blot analysis using Anti-NOP58 antibody HPA018472 (A) shows similar pattern to independent antibody HPA021062 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA018472-100ul |
|
|
HPA018472-100ul |
|
|
HPA018472-100ul |
Produktgarantie und fachkundiger Support
