Anti-MRPS30
Artikelnummer:
ATA-HPA018686
- Bilder (7)
| Artikelname: | Anti-MRPS30 |
| Artikelnummer: | ATA-HPA018686 |
| Hersteller Artikelnummer: | HPA018686 |
| Alternativnummer: | ATA-HPA018686-100,ATA-HPA018686-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PAP, PDCD9 |
| mitochondrial ribosomal protein S30 |
| Anti-MRPS30 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10884 |
| UniProt: | Q9NP92 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MRPS30 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human thyroid gland shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human breast shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes. |
|
|
HPA018686-100ul |
|
|
HPA018686-100ul |
|
|
HPA018686-100ul |
Produktgarantie und fachkundiger Support
