Anti-GPA33
Artikelnummer:
ATA-HPA018858
- Bilder (7)
| Artikelname: | Anti-GPA33 |
| Artikelnummer: | ATA-HPA018858 |
| Hersteller Artikelnummer: | HPA018858 |
| Alternativnummer: | ATA-HPA018858-100,ATA-HPA018858-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | A33 |
| glycoprotein A33 (transmembrane) |
| Anti-GPA33 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10223 |
| UniProt: | Q99795 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GPA33 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human colon and liver tissues using Anti-GPA33 antibody. Corresponding GPA33 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA018858-100ul |
|
|
|
|
|
HPA018858-100ul |
|
|
HPA018858-100ul |
Produktgarantie und fachkundiger Support
