Anti-SPEG
Artikelnummer:
ATA-HPA018904
- Bilder (8)
| Artikelname: | Anti-SPEG |
| Artikelnummer: | ATA-HPA018904 |
| Hersteller Artikelnummer: | HPA018904 |
| Alternativnummer: | ATA-HPA018904-100,ATA-HPA018904-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APEG1, BPEG, KIAA1297, MGC12676, SPEGalpha, SPEGbeta |
| SPEG complex locus |
| Anti-SPEG |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10290 |
| UniProt: | Q15772 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SPEG |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human skeletal muscle and liver tissues using HPA018904 antibody. Corresponding SPEG RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate membranous positivity in striated muscle fibers. |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes. |
|
|
HPA018904-100ul |
|
|
HPA018904-100ul |
|
|
HPA018904-100ul |
Produktgarantie und fachkundiger Support
