Anti-DLEC1
Artikelnummer:
ATA-HPA019077
- Bilder (8)
| Artikelname: | Anti-DLEC1 |
| Artikelnummer: | ATA-HPA019077 |
| Hersteller Artikelnummer: | HPA019077 |
| Alternativnummer: | ATA-HPA019077-100,ATA-HPA019077-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CFAP81, DLC1 |
| deleted in lung and esophageal cancer 1 |
| Anti-DLEC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.6 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9940 |
| UniProt: | Q9Y238 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DLEC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm. |
|
|
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DLEC1 antibody. Corresponding DLEC1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA019077-100ul |
|
|
|
|
|
HPA019077-100ul |
|
|
HPA019077-100ul |
Produktgarantie und fachkundiger Support
