Anti-DNAJC25
Artikelnummer:
ATA-HPA019122
- Bilder (4)
| Artikelname: | Anti-DNAJC25 |
| Artikelnummer: | ATA-HPA019122 |
| Hersteller Artikelnummer: | HPA019122 |
| Alternativnummer: | ATA-HPA019122-100,ATA-HPA019122-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bA16L21.2.1 |
| DnaJ (Hsp40) homolog, subfamily C , member 25 |
| Anti-DNAJC25 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 548645 |
| UniProt: | Q9H1X3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAJC25 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in liver. |
|
|
HPA019122-100ul |
|
|
HPA019122-100ul |
Produktgarantie und fachkundiger Support
