Anti-SLBP
Artikelnummer:
ATA-HPA019254
- Bilder (8)
| Artikelname: | Anti-SLBP |
| Artikelnummer: | ATA-HPA019254 |
| Hersteller Artikelnummer: | HPA019254 |
| Alternativnummer: | ATA-HPA019254-100,ATA-HPA019254-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HBP |
| stem-loop binding protein |
| Anti-SLBP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.6 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7884 |
| UniProt: | Q14493 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CDGDASFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLBP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lymph node and pancreas tissues using Anti-SLBP antibody. Corresponding SLBP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Western blot analysis using Anti-SLBP antibody HPA019254 (A) shows similar pattern to independent antibody HPA061670 (B). |
|
|
HPA019254-100ul |
|
|
|
|
|
HPA019254-100ul |
|
|
HPA019254-100ul |
Produktgarantie und fachkundiger Support
