Anti-ERC1
Artikelnummer:
ATA-HPA019513
- Bilder (7)
| Artikelname: | Anti-ERC1 |
| Artikelnummer: | ATA-HPA019513 |
| Hersteller Artikelnummer: | HPA019513 |
| Alternativnummer: | ATA-HPA019513-100,ATA-HPA019513-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2 |
| ELKS/RAB6-interacting/CAST family member 1 |
| Anti-ERC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23085 |
| UniProt: | Q8IUD2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ERC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & focal adhesion sites. |
|
|
Immunohistochemical staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules and glomeruli. |
|
|
Western blot analysis using Anti-ERC1 antibody HPA019513 (A) shows similar pattern to independent antibody HPA019523 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA019513-100ul |
|
|
HPA019513-100ul |
|
|
HPA019513-100ul |
Produktgarantie und fachkundiger Support
