Anti-SLC35F1
Artikelnummer:
ATA-HPA019576
- Bilder (8)
| Artikelname: | Anti-SLC35F1 |
| Artikelnummer: | ATA-HPA019576 |
| Hersteller Artikelnummer: | HPA019576 |
| Alternativnummer: | ATA-HPA019576-100,ATA-HPA019576-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C6orf169, dJ230I3.1 |
| solute carrier family 35, member F1 |
| Anti-SLC35F1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 222553 |
| UniProt: | Q5T1Q4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC35F1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemistry analysis in human cerebral cortex and lymph node tissues using Anti-SLC35F1 antibody. Corresponding SLC35F1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
HPA019576-100ul |
|
|
|
|
|
HPA019576-100ul |
|
|
HPA019576-100ul |
Produktgarantie und fachkundiger Support
