Anti-CANT1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA019627
Artikelname: Anti-CANT1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA019627
Hersteller Artikelnummer: HPA019627
Alternativnummer: ATA-HPA019627-100,ATA-HPA019627-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SCAN-1, SHAPY
calcium activated nucleotidase 1
Anti-CANT1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 124583
UniProt: Q8WVQ1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CANT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human rectum and pancreas tissues using Anti-CANT1 antibody. Corresponding CANT1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, pancreas, prostate and rectum using Anti-CANT1 antibody HPA019627 (A) shows similar protein distribution across tissues to independent antibody HPA019639 (B).
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human rectum shows high expression.
Immunohistochemical staining of human cerebral cortex using Anti-CANT1 antibody HPA019627.
Immunohistochemical staining of human prostate using Anti-CANT1 antibody HPA019627.
HPA019627
HPA019627
HPA019627