Anti-TRIM35
Artikelnummer:
ATA-HPA019647
- Bilder (8)
| Artikelname: | Anti-TRIM35 |
| Artikelnummer: | ATA-HPA019647 |
| Hersteller Artikelnummer: | HPA019647 |
| Alternativnummer: | ATA-HPA019647-100,ATA-HPA019647-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HLS5, KIAA1098, MAIR |
| tripartite motif containing 35 |
| Anti-TRIM35 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23087 |
| UniProt: | Q9UPQ4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TRIM35 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human appendix shows strong nuclear positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Tonsil tissue |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and TRIM35 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406788). |
|
|
HPA019647-100ul |
|
|
|
|
|
HPA019647-100ul |
|
|
HPA019647-100ul |
Produktgarantie und fachkundiger Support
