Anti-RUVBL1

Artikelnummer: ATA-HPA019947
Artikelname: Anti-RUVBL1
Artikelnummer: ATA-HPA019947
Hersteller Artikelnummer: HPA019947
Alternativnummer: ATA-HPA019947-100,ATA-HPA019947-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ECP54, INO80H, NMP238, Pontin52, RVB1, TIH1, TIP49, TIP49a
RuvB-like AAA ATPase 1
Anti-RUVBL1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 8607
UniProt: Q9Y265
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RUVBL1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-RUVBL1 antibody. Corresponding RUVBL1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-RUVBL1 antibody HPA019947 (A) shows similar protein distribution across tissues to independent antibody HPA019948 (B).
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human testis using Anti-RUVBL1 antibody HPA019947.
Immunohistochemical staining of human lymph node using Anti-RUVBL1 antibody HPA019947.
Immunohistochemical staining of human kidney using Anti-RUVBL1 antibody HPA019947.
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RUVBL1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
HPA019947-100ul
HPA019947-100ul
HPA019947-100ul