Anti-IPPK Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA020603
- Bilder (9)
| Artikelname: | Anti-IPPK Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA020603 |
| Hersteller Artikelnummer: | HPA020603 |
| Alternativnummer: | ATA-HPA020603-100,ATA-HPA020603-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C9orf12, FLJ13163, INSP5K2, IP5K, IPK1 |
| inositol 1,3,4,5,6-pentakisphosphate 2-kinase |
| Anti-IPPK |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 64768 |
| UniProt: | Q9H8X2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IPPK |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in seminiferous duct cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA020603 |
|
|
|
|
|
|
|
|
HPA020603 |
|
|
HPA020603 |
Produktgarantie und fachkundiger Support
