Anti-PRPF4B

Artikelnummer: ATA-HPA020638
Artikelname: Anti-PRPF4B
Artikelnummer: ATA-HPA020638
Hersteller Artikelnummer: HPA020638
Alternativnummer: ATA-HPA020638-100,ATA-HPA020638-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0536, PR4H, Prp4
pre-mRNA processing factor 4B
Anti-PRPF4B
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 8899
UniProt: Q13523
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PRPF4B
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell line HEL.
HPA020638-100ul
HPA020638-100ul
HPA020638-100ul