Anti-HINT2

Artikelnummer: ATA-HPA020961
Artikelname: Anti-HINT2
Artikelnummer: ATA-HPA020961
Hersteller Artikelnummer: HPA020961
Alternativnummer: ATA-HPA020961-100,ATA-HPA020961-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HINT2
histidine triad nucleotide binding protein 2
Anti-HINT2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 84681
UniProt: Q9BX68
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HINT2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
Western blot analysis in human cell line PC-3.
HPA020961-100ul
HPA020961-100ul
HPA020961-100ul