Anti-NOP58
Artikelnummer:
ATA-HPA021062
- Bilder (9)
| Artikelname: | Anti-NOP58 |
| Artikelnummer: | ATA-HPA021062 |
| Hersteller Artikelnummer: | HPA021062 |
| Alternativnummer: | ATA-HPA021062-100,ATA-HPA021062-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HSPC120, NOP5 |
| NOP58 ribonucleoprotein |
| Anti-NOP58 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51602 |
| UniProt: | Q9Y2X3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIAHAGSLL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NOP58 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli fibrillar center. |
|
|
Immunohistochemical staining of human stomach shows nuclear and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-NOP58 antibody HPA021062 (A) shows similar pattern to independent antibody HPA018472 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA021062-100ul |
|
|
|
|
|
|
|
|
HPA021062-100ul |
|
|
HPA021062-100ul |
Produktgarantie und fachkundiger Support
