Anti-EBAG9
Artikelnummer:
ATA-HPA021153
- Bilder (8)
| Artikelname: | Anti-EBAG9 |
| Artikelnummer: | ATA-HPA021153 |
| Hersteller Artikelnummer: | HPA021153 |
| Alternativnummer: | ATA-HPA021153-100,ATA-HPA021153-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EB9, RCAS1 |
| estrogen receptor binding site associated, antigen, 9 |
| Anti-EBAG9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9166 |
| UniProt: | O00559 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | EBAG9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, liver and lymph node using Anti-EBAG9 antibody HPA021153 (A) shows similar protein distribution across tissues to independent antibody HPA021154 (B). |
|
|
Immunohistochemical staining of human colon using Anti-EBAG9 antibody HPA021153. |
|
|
Immunohistochemical staining of human liver using Anti-EBAG9 antibody HPA021153. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-EBAG9 antibody HPA021153. |
|
|
Immunohistochemical staining of human lymph node using Anti-EBAG9 antibody HPA021153. |
|
|
HPA021153-100ul |
|
|
HPA021153-100ul |
|
|
HPA021153-100ul |
Produktgarantie und fachkundiger Support
