Anti-FAM129B
Artikelnummer:
ATA-HPA021417
- Bilder (8)
| Artikelname: | Anti-FAM129B |
| Artikelnummer: | ATA-HPA021417 |
| Hersteller Artikelnummer: | HPA021417 |
| Alternativnummer: | ATA-HPA021417-100,ATA-HPA021417-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bA356B19.6, C9orf88, DKFZP434H0820, FLJ13518, FLJ22151, FLJ22298, MINERVA |
| family with sequence similarity 129, member B |
| Anti-FAM129B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 64855 |
| UniProt: | Q96TA1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM129B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes. |
|
|
Western blot analysis using Anti-FAM129B antibody HPA021417 (A) shows similar pattern to independent antibody HPA023261 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA021417 |
|
|
HPA021417-100ul |
|
|
HPA021417-100ul |
|
|
HPA021417-100ul |
Produktgarantie und fachkundiger Support
