Anti-CHAF1B
Artikelnummer:
ATA-HPA021679
- Bilder (8)
| Artikelname: | Anti-CHAF1B |
| Artikelnummer: | ATA-HPA021679 |
| Hersteller Artikelnummer: | HPA021679 |
| Alternativnummer: | ATA-HPA021679-100,ATA-HPA021679-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAF-1, CAF1, CAF1A, CAF1P60, MPHOSPH7, MPP7 |
| chromatin assembly factor 1, subunit B (p60) |
| Anti-CHAF1B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8208 |
| UniProt: | Q13112 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHAF1B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal centre cells. |
|
|
Western blot analysis in human cell line MOLT-4. |
|
|
|
|
|
HPA021679-100ul |
|
|
|
|
|
HPA021679-100ul |
|
|
HPA021679-100ul |
Produktgarantie und fachkundiger Support
