Anti-LRSAM1

Artikelnummer: ATA-HPA021844
Artikelname: Anti-LRSAM1
Artikelnummer: ATA-HPA021844
Hersteller Artikelnummer: HPA021844
Alternativnummer: ATA-HPA021844-100,ATA-HPA021844-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ31641
leucine rich repeat and sterile alpha motif containing 1
Anti-LRSAM1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 90678
UniProt: Q6UWE0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: REILTELEAKSETRQENYWLIQYQRLLNQKPLSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LRSAM1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA021844-100ul
HPA021844-100ul
HPA021844-100ul